PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID CCG013448.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Salicaceae; Saliceae; Populus
Family G2-like
Protein Properties Length: 351aa    MW: 39248.9 Da    PI: 7.4811
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
CCG013448.1genomeLZUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.21.6e-32219274156
      G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                  k+r++W+peLH+rFv+a++qLGG ++AtPk+i+e+m+v+gLt+++vkSHLQkYRl+
  CCG013448.1 219 KQRRCWSPELHRRFVDALQQLGGCQVATPKQIREHMQVDGLTNDEVKSHLQKYRLH 274
                  79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.93216276IPR017930Myb domain
SuperFamilySSF466892.87E-18217277IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.2E-29218277IPR009057Homeodomain-like
TIGRFAMsTIGR015571.9E-26219274IPR006447Myb domain, plants
PfamPF002496.5E-9221272IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 351 aa     Download sequence    Send to blast
MELSLDLSLV CEPKTINECL KEVSMIKDGS QKLPKLYDYV ERLEDERRKI DAFKRELPLC  60
MLLLNEAIAR LKEEAMQCSE LNDFIPLKGN SSEDGNDKKN WMSSVQLWNT NNHLDCKKQD  120
SKSEPKQKSE EDDDRSTCEN PVQLGNHSNK GGAFVPFKAL SGFEGSKRKE EKEVVSQVTG  180
LSPMNSVPDL SSCNWTRKSN NCSNQTKILS KSQQQAYRKQ RRCWSPELHR RFVDALQQLG  240
GCQVATPKQI REHMQVDGLT NDEVKSHLQK YRLHLRKAPA SPAAPASQDQ CKDPSTGNIS  300
QSNSPKGSLH ASASAKATSN TGGHSMEAED DDKSESHSWN GALHKPGEAH V
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2165990.0AC216599.1 Populus trichocarpa clone POP051-K05, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011039217.10.0PREDICTED: probable transcription factor KAN3
TrEMBLB9HE750.0B9HE75_POPTR; Uncharacterized protein
STRINGPOPTR_0007s11470.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF120834107
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.17e-69G2-like family protein